PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0578s0070.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 256aa    MW: 28917.6 Da    PI: 6.3771
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0578s0070.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.71.3e-27959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         k+ien   rqvtfskRrng++KKA+ELS+LCdaeva+iifsstgk+y++ss
  Cagra.0578s0070.1.p  9 KKIENVNSRQVTFSKRRNGLIKKAKELSILCDAEVALIIFSSTGKIYDFSS 59
                         68***********************************************96 PP

2K-box53.51e-18891781099
                K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                          +++++e   ++ + +k e+e Lq  + +l+G++L+ +s+ +L  Le+qL++sl +++++K+++ll+qie+++ +ek++ een+ Lrk++e
  Cagra.0578s0070.1.p  89 SSHENEAVLRNDDSMKGELERLQLAIERLKGKELDGMSFPDLITLENQLNESLHSVKDQKTKFLLNQIERSRLQEKRALEENQILRKQVE 178
                          55667777788899*************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.6E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.917161IPR002100Transcription factor, MADS-box
CDDcd002651.55E-40269No hitNo description
SuperFamilySSF554559.29E-31274IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-29323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-293859IPR002100Transcription factor, MADS-box
PfamPF014861.2E-1591177IPR002487Transcription factor, K-box
PROSITE profilePS5129712.66293183IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009910Biological Processnegative regulation of flower development
GO:0048577Biological Processnegative regulation of short-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MGRGRIEIKK IENVNSRQVT FSKRRNGLIK KAKELSILCD AEVALIIFSS TGKIYDFSSV  60
CMEQILSRYG YTAASTEHKQ REKQLLLCSS HENEAVLRND DSMKGELERL QLAIERLKGK  120
ELDGMSFPDL ITLENQLNES LHSVKDQKTK FLLNQIERSR LQEKRALEEN QILRKQVELL  180
GRSSVPKVLS ERPQISSPEA DRESSSSDDD ENDNEEHHSD TSLQLGLSST GYCTQRKKPK  240
MELVCDNSGS QVASD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-19181179Myocyte-specific enhancer factor 2B
1tqe_Q4e-19181179Myocyte-specific enhancer factor 2B
1tqe_R4e-19181179Myocyte-specific enhancer factor 2B
1tqe_S4e-19181179Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3126630.0AF312663.1 Arabidopsis thaliana MADS-box protein AGL18 (AGL18) mRNA, complete cds.
GenBankAK2222200.0AK222220.1 Arabidopsis thaliana mRNA for MADS transcription factor-like protein, complete cds, clone: RAFL25-29-C20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006291720.10.0hypothetical protein CARUB_v10017886mg
SwissprotQ9M2K81e-160AGL18_ARATH; Agamous-like MADS-box protein AGL18
TrEMBLR0HL440.0R0HL44_9BRAS; Uncharacterized protein
STRINGAT3G57390.11e-158(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60612139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57390.11e-156AGAMOUS-like 18